HPA008880

ME2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008880
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008880, RRID:AB_1853702
Product name
Anti-ME2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008880
Antibody type
Polyclonal
Antigen
NAD-dependent malic enzyme, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVISKPISEHKILFLGAGEAALGIANLIVMSMVEN
GLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPF
THSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFT
PDVIRAMASINERPVIFALSNPTA
Storage
-20C
Provider Type Product Number
- No reagents -