HPA022013

ARPC5L antibody from Atlas Antibodies
ARC16-2, MGC3038
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022013
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022013, RRID:AB_1845045
Product name
Anti-ARPC5L
Provider product page
Atlas Antibodies - HPA022013
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTE
NSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -