HPA022013

ARPC5L antibody from Sigma-Aldrich
ARC16-2, MGC3038
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022013
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022013, RRID:AB_1845045
Product name
Anti-ARPC5L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022013
Antibody type
Polyclonal
Antigen
Actin-related protein 2/3 complex subunit 5-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTE
NSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Storage
-20C
Provider Type Product Number
- No reagents -