ABIN630027

antibody from antibodies-online

Targeting: RBM4B MGC10871, RBM30, RBM4L, ZCCHC15, ZCCHC21B, ZCRB3B

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630027 - Provider product page
Provider: antibodies-online
Product name: anti-RNA Binding Motif Protein 4B (RBM4B) (C-Term) antibody
Antibody type: Polyclonal
Antigen: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: C-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

RBM4B protein structure - ABIN630027 shown in red.