Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023411-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023411-M01, RRID:AB_607025
- Product name
- SIRT1 monoclonal antibody (M01), clone 7B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SIRT1.
- Antigen sequence
NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQS
PSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGF
GTDGDDQEAINEAISVKQEVTDMNYPSNKS- Isotype
- IgG
- Antibody clone number
- 7B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Simvastatin inhibits cysteine-rich protein 61 expression in rheumatoid arthritis synovial fibroblasts through the regulation of sirtuin-1/FoxO3a signaling.
Remodeling of ribosomal genes in somatic cells by Xenopus egg extract.
Identification of DBC1 as a transcriptional repressor for BRCA1.
Kok SH, Lin LD, Hou KL, Hong CY, Chang CC, Hsiao M, Wang JH, Lai EH, Lin SK
Arthritis and rheumatism 2013 Mar;65(3):639-49
Arthritis and rheumatism 2013 Mar;65(3):639-49
Remodeling of ribosomal genes in somatic cells by Xenopus egg extract.
Østrup O, Hyttel P, Klærke DA, Collas P
Biochemical and biophysical research communications 2011 Sep 2;412(3):487-93
Biochemical and biophysical research communications 2011 Sep 2;412(3):487-93
Identification of DBC1 as a transcriptional repressor for BRCA1.
Hiraike H, Wada-Hiraike O, Nakagawa S, Koyama S, Miyamoto Y, Sone K, Tanikawa M, Tsuruga T, Nagasaka K, Matsumoto Y, Oda K, Shoji K, Fukuhara H, Saji S, Nakagawa K, Kato S, Yano T, Taketani Y
British journal of cancer 2010 Mar 16;102(6):1061-7
British journal of cancer 2010 Mar 16;102(6):1061-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SIRT1 monoclonal antibody (M01), clone 7B7 Western Blot analysis of SIRT1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SIRT1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SIRT1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SIRT1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol