HPA011387

SGK2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011387
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011387, RRID:AB_1856744
Product name
Anti-SGK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011387
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase Sgk2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQD
VSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQ
RQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPP
FNPNVTGPADLKHFDPEFTQEAVSKSIGCTPD
Storage
-20C
Provider Type Product Number
- No reagents -