HPA023920

RABEPK antibody from Sigma-Aldrich
bA65N13.1, RAB9P40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023920
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023920, RRID:AB_1856023
Product name
Anti-RABEPK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023920
Antibody type
Polyclonal
Antigen
Rab9 effector protein with Kelch motifs recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAI
GNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQP
ETLGNPPSPRH
Storage
-20C
Provider Type Product Number
- No reagents -