HPA006427

PLIN3 antibody from Atlas Antibodies
M6PRBP1, PP17, TIP47
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006427
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006427, RRID:AB_1079289
Product name
Anti-PLIN3
Provider product page
Atlas Antibodies - HPA006427
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQ
KLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVE
SRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQ
VQQARRQVEDLQATFSSIHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -