Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20893 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20893, RRID:AB_10967767
- Product name
- TEX261 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TEX261.
- Antigen sequence
NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSF
IKEAILPSRQKIY- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TEX261 polyclonal antibody (Cat # PAB20893) at 1:250-1:500 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of cell lysates with TEX261 polyclonal antibody (Cat # PAB20893) at 1:250-1:500 dilution.Lane 1 : NIH/3T3Lane 2 : NBT-II
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human smooth muscle with TEX261 polyclonal antibody (Cat # PAB20893) shows strong positivity in smooth muscle cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)