HPA016631

TEX261 antibody from Sigma-Aldrich
MGC32043, TEG-261
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016631
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016631, RRID:AB_2240434
Product name
Anti-TEX261 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016631
Antibody type
Polyclonal
Antigen
Protein TEX261 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSF
IKEAILPSRQKIY
Storage
-20C
Provider Type Product Number
- No reagents -