ABIN629728

antibody from antibodies-online

Targeting: METTL1 C12orf1, TRM8, TRMT8

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629728 - Provider product page
Provider: antibodies-online
Product name: anti-Methyltransferase Like 1 (METTL1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

METTL1 protein structure - ABIN629728 shown in red.