HPA003086

STON2 antibody from Sigma-Aldrich
STN2, STNB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003086
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003086, RRID:AB_2302748
Product name
Anti-STON2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003086
Antibody type
Polyclonal
Antigen
Stonin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTPSVTEAPPWRATNPFLNETLQDVQPSPINPFSA
FFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAIS
FDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPD
DDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEK
Storage
-20C
Provider Type Product Number
- No reagents -