Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405701 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Carnitine Palmitoyltransferase 1A (Liver) (CPT1A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CPT1A antibody: synthetic peptide directed towards the middle region of human CPT1A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADD
GYGVS YILVGENLIN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references New 2-(aryloxy)-3-phenylpropanoic acids as peroxisome proliferator-activated receptor α/γ dual agonists able to upregulate mitochondrial carnitine shuttle system gene expression.
Carnitine palmitoyltransferase I and Acyl-CoA dehydrogenase 9 in retina: insights of retinopathy in mitochondrial trifunctional protein defects.
Laghezza A, Pochetti G, Lavecchia A, Fracchiolla G, Faliti S, Piemontese L, Di Giovanni C, Iacobazzi V, Infantino V, Montanari R, Capelli D, Tortorella P, Loiodice F
Journal of medicinal chemistry 2013 Jan 10;56(1):60-72
Journal of medicinal chemistry 2013 Jan 10;56(1):60-72
Carnitine palmitoyltransferase I and Acyl-CoA dehydrogenase 9 in retina: insights of retinopathy in mitochondrial trifunctional protein defects.
Roomets E, Kivelä T, Tyni T
Investigative ophthalmology & visual science 2008 Apr;49(4):1660-4
Investigative ophthalmology & visual science 2008 Apr;49(4):1660-4
No comments: Submit comment
No validations: Submit validation data