HPA008835

CPT1A antibody from Sigma-Aldrich
CPT1, CPT1-L, L-CPT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008835, RRID:AB_1078563
Product name
Anti-CPT1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008835
Antibody type
Polyclonal
Antigen
Carnitine O-palmitoyltransferase 1, liver isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEG
YRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVV
FKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQL
GYA
Storage
-20C
Provider Type Product Number
- No reagents -