HPA055018

ZNF607 antibody from Atlas Antibodies
FLJ14802, MGC13071
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA055018
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055018, RRID:AB_2682674
Product name
Anti-ZNF607
Provider product page
Atlas Antibodies - HPA055018
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IVREETRGECTDLDSRCEIISDGKMQLYRKHSCVT
LHQRIHNG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -