AV36078

ZNF607 antibody from Sigma-Aldrich
FLJ14802, MGC13071
No application information provided.

Antibody data

Product number
AV36078
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36078, RRID:AB_1859374
Product name
Anti-ZNF607 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36078
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF607 with an internal ID of P07388
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTF
ESVEKPYKCEECGKA
Storage
-20C
Provider Type Product Number
- No reagents -