HPA019359

MAP11 antibody from Atlas Antibodies
C7orf43, FLJ10925
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019359
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019359, RRID:AB_1848677
Product name
Anti-C7orf43
Provider product page
Atlas Antibodies - HPA019359
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRK
SSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHL
MRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSL
DKIAKRECKVLVVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -