Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404903 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Dehydrogenase, Long Chain (ACADL) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACADL antibody: synthetic peptide directed towards the middle region of human ACADL
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
LPQERLLIADVAISASEFMFEETRNYVKQRKAFGK
TVAHL QTVQHKLAEL- Vial size
- 50 µg
Submitted references Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet.
Long-chain acyl-CoA dehydrogenase is a key enzyme in the mitochondrial beta-oxidation of unsaturated fatty acids.
Mells JE, Fu PP, Sharma S, Olson D, Cheng L, Handy JA, Saxena NK, Sorescu D, Anania FA
American journal of physiology. Gastrointestinal and liver physiology 2012 Jan 15;302(2):G225-35
American journal of physiology. Gastrointestinal and liver physiology 2012 Jan 15;302(2):G225-35
Long-chain acyl-CoA dehydrogenase is a key enzyme in the mitochondrial beta-oxidation of unsaturated fatty acids.
Lea W, Abbas AS, Sprecher H, Vockley J, Schulz H
Biochimica et biophysica acta 2000 May 31;1485(2-3):121-8
Biochimica et biophysica acta 2000 May 31;1485(2-3):121-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting