HPA011990

ACADL antibody from Sigma-Aldrich
ACAD4, LCAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011990, RRID:AB_1844465
Product name
Anti-ACADL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011990
Antibody type
Polyclonal
Antigen
Long-chain specific acyl-CoA dehydrogenase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRK
FFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGV
NIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSI
HSGIVMSYITNHGSEEQIKHFIPQMT
Storage
-20C
Provider Type Product Number
- No reagents -