SAB2100020

ACADL antibody from Sigma-Aldrich
ACAD4, LCAD
No application information provided.

Antibody data

Product number
SAB2100020
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100020, RRID:AB_10605668
Product name
Anti-ACADL antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100020
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001599.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPQERLLIADVAISASEFMFEETRNYVKQRKAFGK
TVAHLQTVQHKLAEL
Storage
-20C
Provider Type Product Number
- No reagents -