HPA006198

ACADM antibody from MilliporeSigma / Merck KGaA
ACAD1, MCAD, MCADH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006198
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006198, RRID:AB_1078087
Product name
Anti-ACADM antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006198
Antibody type
Polyclonal
Antigen
Medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AWELGLMNTHIPENCGGLGLGTFDACLISEELAYG
CTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMT
EEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYII
NGQKMWITNGGKANWYFLLARSDPDPKA
Storage
-20C
Provider Type Product Number
- No reagents -