HPA026542

ACADM antibody from Sigma-Aldrich
ACAD1, MCAD, MCADH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026542
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026542, RRID:AB_1844469
Product name
Anti-ACADM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026542
Antibody type
Polyclonal
Antigen
Medium-chain specific acyl-CoA dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIV
FEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAA
GAVGLAQRALDEATKYALERKTFGKLLVEHQAISF
MLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASI
AKAFAGDIA
Storage
-20C
Provider Type Product Number
- No reagents -