Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310333 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-RHOD (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RHOD antibody: synthetic peptide directed towards the N terminal of human RHOD
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMV
FADGA FPESYTPTVF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.
Tong Y, Chugha P, Hota PK, Alviani RS, Li M, Tempel W, Shen L, Park HW, Buck M
The Journal of biological chemistry 2007 Dec 21;282(51):37215-24
The Journal of biological chemistry 2007 Dec 21;282(51):37215-24
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry