Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487183 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RHOD (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVH
AVFQE AAEVALSSRG- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.
Tong Y, Chugha P, Hota PK, Alviani RS, Li M, Tempel W, Shen L, Park HW, Buck M
The Journal of biological chemistry 2007 Dec 21;282(51):37215-24
The Journal of biological chemistry 2007 Dec 21;282(51):37215-24
No comments: Submit comment
No validations: Submit validation data