HPA024394

RHOD antibody from Sigma-Aldrich
ARHD, Rho, RhoD, RhoHP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024394
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024394, RRID:AB_1856266
Product name
Anti-RHOD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024394
Antibody type
Polyclonal
Antigen
Rho-related GTP-binding protein RhoD Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKV
PIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQ
EMARSVGAVAYLECSARLHDNVHAVFQEAAEVALS
S
Storage
-20C
Provider Type Product Number
- No reagents -