Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182678 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETS
DGGVY WEGIDEPLAS- Vial size
- 50 µg
Submitted references Genomic and metabolic responses to methionine-restricted and methionine-restricted, cysteine-supplemented diets in Fischer 344 rat inguinal adipose tissue, liver and quadriceps muscle.
SREBP-1c and Sp1 interact to regulate transcription of the gene for phosphoenolpyruvate carboxykinase (GTP) in the liver.
Perrone CE, Mattocks DA, Plummer JD, Chittur SV, Mohney R, Vignola K, Orentreich DS, Orentreich N
Journal of nutrigenetics and nutrigenomics 2012;5(3):132-57
Journal of nutrigenetics and nutrigenomics 2012;5(3):132-57
SREBP-1c and Sp1 interact to regulate transcription of the gene for phosphoenolpyruvate carboxykinase (GTP) in the liver.
Chakravarty K, Wu SY, Chiang CM, Samols D, Hanson RW
The Journal of biological chemistry 2004 Apr 9;279(15):15385-95
The Journal of biological chemistry 2004 Apr 9;279(15):15385-95
No comments: Submit comment
No validations: Submit validation data