HPA006507

PCK1 antibody from Sigma-Aldrich
PEPCK-C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006507
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006507, RRID:AB_1079578
Product name
Anti-PCK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006507
Antibody type
Polyclonal
Antigen
Phosphoenolpyruvate carboxykinase, cytosolic [GTP] recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFR
KDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLT
PIGYIPKEDALNLKGLGHINMMELFSISKEFWEKE
VEDIEKYLEDQVNADLPC
Storage
-20C
Provider Type Product Number
- No reagents -