H00009572-M14
antibody from Abnova Corporation
Targeting: NR1D1
ear-1, hRev, Rev-ErbAalpha, REVERBA, REVERBalpha, THRA1, THRAL
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009572-M14 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009572-M14, RRID:AB_1136974
- Product name
- NR1D1 monoclonal antibody (M14), clone 1E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant NR1D1.
- Antigen sequence
SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFS
QFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGSSPGNFNANHASG- Isotype
- IgG
- Antibody clone number
- 1E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data