H00009572-M15

NR1D1 antibody from Abnova Corporation
ear-1, hRev, Rev-ErbAalpha, REVERBA, REVERBalpha, THRA1, THRAL

Antibody data

Product number
H00009572-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009572-M15, RRID:AB_1136972
Product name
NR1D1 monoclonal antibody (M15), clone 2G6
Provider product page
Abnova Corporation - H00009572-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NR1D1.
Antigen sequence
SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFS
QFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGSSPGNFNANHASG
Isotype
IgG
Antibody clone number
2G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -