H00009572-M18

NR1D1 antibody from Abnova Corporation
ear-1, hRev, Rev-ErbAalpha, REVERBA, REVERBalpha, THRA1, THRAL
No application information provided.

Antibody data

Product number
H00009572-M18
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009572-M18, RRID:AB_1136973
Product name
NR1D1 monoclonal antibody (M18), clone 4C2
Provider product page
Abnova Corporation - H00009572-M18
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NR1D1.
Antigen sequence
SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFS
QFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGSSPGNFNANHASG
Isotype
IgG
Antibody clone number
4C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -