HPA027406

PPP1R8 antibody from Atlas Antibodies
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA027406
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027406, RRID:AB_1669431
Product name
Anti-PPP1R8
Provider product page
Atlas Antibodies - HPA027406
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIIN
PEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGL
EESGSRRMQNFAFSGGLY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -