HPA027452

PPP1R8 antibody from Atlas Antibodies
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027452
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027452, RRID:AB_1854490
Product name
Anti-PPP1R8
Provider product page
Atlas Antibodies - HPA027452
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLRE
KPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETEL
DNLTEFNTAHNK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -