H00005511-M05

PPP1R8 antibody from Abnova Corporation
ard-1, ARD1, NIPP-1, NIPP1, PRO2047

Antibody data

Product number
H00005511-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005511-M05, RRID:AB_1204824
Product name
PPP1R8 monoclonal antibody (M05), clone 4B5
Provider product page
Abnova Corporation - H00005511-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PPP1R8.
Antigen sequence
RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTAL
IGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAV
YNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Isotype
IgG
Antibody clone number
4B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -