H00005511-M05
antibody from Abnova Corporation
Targeting: PPP1R8
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005511-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005511-M05, RRID:AB_1204824
- Product name
- PPP1R8 monoclonal antibody (M05), clone 4B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPP1R8.
- Antigen sequence
RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTAL
IGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAV
YNPEAVNEPKKKKYAKEAWPGKKPTPSLLI- Isotype
- IgG
- Antibody clone number
- 4B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PPP1R8 expression in transfected 293T cell line by PPP1R8 monoclonal antibody (M05), clone 4B5.Lane 1: PPP1R8 transfected lysate (Predicted MW: 38.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PPP1R8 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PPP1R8 transfected lysate using anti-PPP1R8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PPP1R8 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol