HPA008255

SLC27A1 antibody from Sigma-Aldrich
ACSVL5, FATP, FATP1, FLJ00336, MGC71751
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008255
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008255, RRID:AB_1080002
Product name
Anti-SLC27A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008255
Antibody type
Polyclonal
Antigen
Long-chain fatty acid transport protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAE
VSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLKE
ASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIV
VHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSA
Storage
-20C
Provider Type Product Number
- No reagents -