Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501691 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-POU Domain, Class 4, Transcription Factor 2 (POU4F2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-POU4F2 antibody: synthetic peptide directed towards the middle region of human POU4F2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFC
NQRQK QKRMKYSAGI- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A comprehensive negative regulatory program controlled by Brn3b to ensure ganglion cell specification from multipotential retinal precursors.
Qiu F, Jiang H, Xiang M
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Mar 26;28(13):3392-403
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Mar 26;28(13):3392-403
No comments: Submit comment
No validations: Submit validation data