Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309896 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-POU Domain, Class 4, Transcription Factor 2 (POU4F2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-POU4F2 antibody: synthetic peptide directed towards the N terminal of human POU4F2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPG
SSAPI APSASSPSSS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Use of a synthetic xeno-free culture substrate for induced pluripotent stem cell induction and retinal differentiation.
The Brn-3b POU family transcription factor represses plakoglobin gene expression in human breast cancer cells.
Tucker BA, Anfinson KR, Mullins RF, Stone EM, Young MJ
Stem cells translational medicine 2013 Jan;2(1):16-24
Stem cells translational medicine 2013 Jan;2(1):16-24
The Brn-3b POU family transcription factor represses plakoglobin gene expression in human breast cancer cells.
Samady L, Faulkes DJ, Budhram-Mahadeo V, Ndisang D, Potter E, Brabant G, Latchman DS
International journal of cancer. Journal international du cancer 2006 Feb 15;118(4):869-78
International journal of cancer. Journal international du cancer 2006 Feb 15;118(4):869-78
No comments: Submit comment
No validations: Submit validation data