HPA022895

RAPGEFL1 antibody from Sigma-Aldrich
Link-GEFII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022895
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022895, RRID:AB_1856071
Product name
Anti-RAPGEFL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022895
Antibody type
Polyclonal
Antigen
Rap guanine nucleotide exchange factor-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAG
HIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVE
LKIPEENQPPSKQVKPLFRHFRRIDS
Storage
-20C
Provider Type Product Number
- No reagents -