Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054961-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054961-M01, RRID:AB_607097
- Product name
- SSH3 monoclonal antibody (M01), clone 6F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SSH3.
- Antigen sequence
SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRD
RASRIFPHLYLGSEWNAANLEELQRNRVTHILNMA
REIDNFYPERFTYHNVRLWDEESAQLLPH- Isotype
- IgG
- Antibody clone number
- 6F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SSH3 monoclonal antibody (M01), clone 6F9 Western Blot analysis of SSH3 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody (M01), clone 6F9.Lane 1: SSH3 transfected lysate(73 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SSH3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SSH3 transfected lysate using anti-SSH3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SSH3 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol