HPA019949

SSH3 antibody from Sigma-Aldrich
FLJ10928, FLJ20515
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019949, RRID:AB_1857498
Product name
Anti-SSH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019949
Antibody type
Polyclonal
Antigen
Protein phosphatase Slingshot homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKQYECSLEQALRHVQELRPIARPNPGFLRQLQIY
QGILTASRQSHVWEQKVGGVSPEEHPAPEVSTPFP
PLPPEPE
Storage
-20C
Provider Type Product Number
- No reagents -