HPA006741

FADS2 antibody from Sigma-Aldrich
D6D, DES6, FADSD6, LLCDL2, SLL0262, TU13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006741
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006741, RRID:AB_1078796
Product name
Anti-FADS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006741
Antibody type
Polyclonal
Antigen
fatty acid desaturase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRW
LVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDA
FRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKN
SKITEDFRALRKTAEDMNLFKTNH
Storage
-20C
Provider Type Product Number
- No reagents -