HPA024467

WIPF2 antibody from Sigma-Aldrich
WICH, WIRE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024467
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024467, RRID:AB_1858842
Product name
Anti-WIPF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024467
Antibody type
Polyclonal
Antigen
WAS/WASL-interacting protein family member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPP
LRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPE
EYKHFQ
Storage
-20C
Provider Type Product Number
- No reagents -