Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109575 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 318 (Znf318) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF318 antibody: synthetic peptide directed towards the N terminal of human ZNF318
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDY
RTKETFLHRSDYSPH- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The transcript for a novel protein with a zinc finger motif is expressed at specific stages of mouse spermatogenesis.
Inoue A, Ishiji A, Kasagi S, Ishizuka M, Hirose S, Baba T, Hagiwara H
Biochemical and biophysical research communications 2000 Jul 5;273(2):398-403
Biochemical and biophysical research communications 2000 Jul 5;273(2):398-403
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Stomach; WB Suggested Anti-ZNF318 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Stomach; ZNF318 antibody - N-terminal region (AP42119PU-N) in Human Stomach cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Pancreas; ZNF318 antibody - N-terminal region (AP42119PU-N) in Human Pancreas cells using Immunohistochemistry