HPA027022

ZNF318 antibody from Sigma-Aldrich
HRIHFB2436, ZFP318
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027022
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027022, RRID:AB_1859189
Product name
Anti-ZNF318 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027022
Antibody type
Polyclonal
Antigen
Zinc finger protein 318 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IENKGTMVETALKEPQGNLYQWGPLPGIPKDNSPL
REKFGSFLCHKDNLDLKAEGPERHTDFLLPHERAS
QDGSGFSRILSMLADSTSTQEKRRRSFPDIEDEEK
FLYGDEEEDLKAESVPKP
Storage
-20C
Provider Type Product Number
- No reagents -