HPA007029

COL6A2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007029
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007029, RRID:AB_1078549
Product name
Anti-COL6A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007029
Antibody type
Polyclonal
Antigen
Collagen alpha-2(VI) chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTD
ILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGL
HFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFT
DCALANMTEQIRQDR
Storage
-20C
Provider Type Product Number
- No reagents -