HPA016808

ZDHHC23 antibody from Sigma-Aldrich
MGC42530
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016808
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016808, RRID:AB_1859002
Product name
Anti-ZDHHC23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016808
Antibody type
Polyclonal
Antigen
Palmitoyltransferase ZDHHC23, probable recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEK
NHVATCLCDCQDLDEGCDRWITCKSLQPETCERIM
DTISDRLRIPWLR
Storage
-20C
Provider Type Product Number
- No reagents -