HPA027766

VAC14 antibody from Atlas Antibodies
ArPIKfyve, FLJ10305, TAX1BP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027766
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027766, RRID:AB_1848651
Product name
Anti-VAC14
Provider product page
Atlas Antibodies - HPA027766
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IVQVLNCHLSDTAIGMMTRIAVLKWLYHLYIKTPR
KMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEI
ASSPAGQTDDPGPLDGPDLQASHSELQVPTPGRAG
LLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFS
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -