Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005914-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005914-M02, RRID:AB_606914
- Product name
- RARA monoclonal antibody (M02), clone 1C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RARA.
- Antigen sequence
QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVD
MLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDL
RSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
LDTLS- Isotype
- IgG
- Antibody clone number
- 1C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RARA monoclonal antibody (M02), clone 1C10. Western Blot analysis of RARA expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between RXRA and RARA. HeLa cells were stained with anti-RXRA rabbit purified polyclonal 1:1200 and anti-RARA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)