Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005914-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005914-M03, RRID:AB_714833
- Product name
- RARA monoclonal antibody (M03), clone 2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RARA.
- Antigen sequence
QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVD
MLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDL
RSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
LDTLS- Isotype
- IgG
- Antibody clone number
- 2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Moz and retinoic acid coordinately regulate H3K9 acetylation, Hox gene expression, and segment identity.
Voss AK, Collin C, Dixon MP, Thomas T
Developmental cell 2009 Nov;17(5):674-86
Developmental cell 2009 Nov;17(5):674-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RARA monoclonal antibody (M03), clone 2D2 Western Blot analysis of RARA expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RARA is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
