Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310727 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-phosphodiesterase 9A (PDE9A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDE9A antibody: synthetic peptide directed towards the N terminal of human PDE9A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Zebrafish
- Host
- Rabbit
- Antigen sequence
SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPR
RDVPT YPKYLLSPET- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor 3-isobutyl-1-methylxanthine binding.
Huai Q, Wang H, Zhang W, Colman RW, Robinson H, Ke H
Proceedings of the National Academy of Sciences of the United States of America 2004 Jun 29;101(26):9624-9
Proceedings of the National Academy of Sciences of the United States of America 2004 Jun 29;101(26):9624-9
No comments: Submit comment
No validations: Submit validation data