HPA011380

PDE9A antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011380
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011380, RRID:AB_1235139
Product name
Anti-PDE9A
Provider product page
Atlas Antibodies - HPA011380
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECNIFSNIPPDGFKQIRQGMITLILATDMARHAEI
MDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNE
VRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPF
MDRDKVTKATAQIGFIKFVLIPMF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -